SCOP 1.65: Domain d1koa_1: 1koa 6265-6361

Lineage for d1koa_1 (1koa 6265-6361)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (29 proteins)

6. Protein Twitchin [49174] (2 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
   different modules

8. Domain d1koa_1: 1koa 6265-6361 [21712]
   Other proteins in same PDB: d1koa_2

Details for d1koa_1

PDB Entry: 1koa, 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains

SCOP Domain Sequences for d1koa_1:

Sequence; same for both SEQRES and ATOM records:

>d1koa_1 b.1.1.4 (6265-6361) Twitchin {Nematode (Caenorhabditis elegans)}
qprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndyglt
inrvkgddkgeytvraknsygtkeeivflnvtrhsep

Timeline for d1koa_1:

• d1koa_1 first appeared (with stable ids) in SCOP 1.55
  
• d1koa_1 appears in SCOP 1.63
  
• d1koa_1 appears in SCOP 1.67
  
• d1koa_1 appears in the current release, SCOPe 2.08, called d1koaa1