Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Twitchin [49174] (2 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries) different modules |
Domain d1koaa1: 1koa A:6265-6361 [21712] Other proteins in same PDB: d1koaa2 |
PDB Entry: 1koa (more details), 3.3 Å
SCOPe Domain Sequences for d1koaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} qprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndyglt inrvkgddkgeytvraknsygtkeeivflnvtrhsep
Timeline for d1koaa1: