Lineage for d1koaa1 (1koa A:6265-6361)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Twitchin [49174] (2 species) Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
different modules
Domain d1koaa1: 1koa A:6265-6361 [21712]
Other proteins in same PDB: d1koaa2
Details for d1koaa1
PDB Entry: 1koa (more details), 3.3 Å
PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains
PDB Compounds: (A:) twitchinSCOPe Domain Sequences for d1koaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndyglt
inrvkgddkgeytvraknsygtkeeivflnvtrhsep
SCOPe Domain Coordinates for d1koaa1:
Click to download the PDB-style file with coordinates for d1koaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1koaa1:
- d1koaa1 first appeared (with stable ids) in SCOP 1.55, called d1koa_1
- d1koaa1 appears in SCOPe 2.07
View in 3D
