![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (34 proteins) |
![]() | Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries) |
![]() | Domain d1bqsa1: 1bqs A:1-90 [21704] |
PDB Entry: 1bqs (more details), 2.2 Å
SCOP Domain Sequences for d1bqsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqsa1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens)} vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr naslsaagtrvcvgscggrtfqhtvqllvy
Timeline for d1bqsa1: