SCOP 1.69: Domain d1bqsa1: 1bqs A:1-90

Lineage for d1bqsa1 (1bqs A:1-90)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries)

8. Domain d1bqsa1: 1bqs A:1-90 [21704]

Details for d1bqsa1

PDB Entry: 1bqs, 2.2 Å

PDB Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)

SCOP Domain Sequences for d1bqsa1:

Sequence; same for both SEQRES and ATOM records:

>d1bqsa1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens)}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

Timeline for d1bqsa1:

• d1bqsa1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqsa1 appears in SCOP 1.67
  
• d1bqsa1 appears in SCOP 1.71
  
• d1bqsa1 appears in the current release, SCOPe 2.08