Lineage for d1bqsa1 (1bqs A:1-90)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104875Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)
  7. 104876Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries)
  8. 104879Domain d1bqsa1: 1bqs A:1-90 [21704]

Details for d1bqsa1

PDB Entry: 1bqs (more details), 2.2 Å

PDB Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)

SCOP Domain Sequences for d1bqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqsa1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens)}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

SCOP Domain Coordinates for d1bqsa1:

Click to download the PDB-style file with coordinates for d1bqsa1.
(The format of our PDB-style files is described here.)

Timeline for d1bqsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqsa2