Lineage for d3tqpa1 (3tqp A:2-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649417Species Coxiella burnetii [TaxId:777] [226217] (1 PDB entry)
  8. 1649418Domain d3tqpa1: 3tqp A:2-138 [216984]
    Other proteins in same PDB: d3tqpa2, d3tqpb2
    automated match to d1iyxa2
    complexed with mg, po4

Details for d3tqpa1

PDB Entry: 3tqp (more details), 2.2 Å

PDB Description: structure of an enolase (eno) from coxiella burnetii
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d3tqpa1:

Sequence, based on SEQRES records: (download)

>d3tqpa1 d.54.1.0 (A:2-138) automated matches {Coxiella burnetii [TaxId: 777]}
tatitdinaheildsranptlevrvtlssqaygcaavpsgastgereavelrdndleryg
gkgvlqavenvngpirdallgqdprsqeeidrimieldgtenkanlganailgvslavay
aaannadlplyrylggd

Sequence, based on observed residues (ATOM records): (download)

>d3tqpa1 d.54.1.0 (A:2-138) automated matches {Coxiella burnetii [TaxId: 777]}
tatitdinaheildsranptlevrvtlssqaygcaavpsgaereavelrdndleryggkg
vlqavenvngpirdallgqdprsqeeidrimieldgtenkanlganailgvslavayaaa
nnadlplyrylggd

SCOPe Domain Coordinates for d3tqpa1:

Click to download the PDB-style file with coordinates for d3tqpa1.
(The format of our PDB-style files is described here.)

Timeline for d3tqpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqpa2