Lineage for d3tpch_ (3tpc H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456687Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)
  8. 2456703Domain d3tpch_: 3tpc H: [216954]
    automated match to d3ay6a_

Details for d3tpch_

PDB Entry: 3tpc (more details), 2.34 Å

PDB Description: crystal structure of a hypothtical protein sma1452 from sinorhizobium meliloti 1021
PDB Compounds: (H:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d3tpch_:

Sequence, based on SEQRES records: (download)

>d3tpch_ c.2.1.0 (H:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
qlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrnadvt
neadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnm
irlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelar
fgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentmlng
evirldgalrm

Sequence, based on observed residues (ATOM records): (download)

>d3tpch_ c.2.1.0 (H:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
qlksrvfivtgassglgaavtrmlaqegatvlgldlvrfrnadvtneadataalafakqe
fghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgepda
dgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgifdt
pasvpfpprlgraeeyaalvkhicentmlngevirldgalrm

SCOPe Domain Coordinates for d3tpch_:

Click to download the PDB-style file with coordinates for d3tpch_.
(The format of our PDB-style files is described here.)

Timeline for d3tpch_: