Lineage for d3toib_ (3toi B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690950Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)
  8. 1691014Domain d3toib_: 3toi B: [216915]
    automated match to d1omeb_

Details for d3toib_

PDB Entry: 3toi (more details), 1.9 Å

PDB Description: Tailoring Enzyme Stability and Exploiting Stability-Trait Linkage by Iterative Truncation and Optimization
PDB Compounds: (B:) Ampicillin resistance protein

SCOPe Domain Sequences for d3toib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toib_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
arvgyieldlnsgkvlesfrpeerfpmmstfkvllcgavlsridagqeqlgrrihysqnd
lveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggpkeltaflhnmgdhvtr
ldrwepelneaipnderdtttpvamattlrkllsgelltlasrqqlmdwmeadkvagpll
rsvlpagwfiadksgagehgsrgiiaalgpdgkpsrivviymtgsqatmdernrqiaeig
aslig

SCOPe Domain Coordinates for d3toib_:

Click to download the PDB-style file with coordinates for d3toib_.
(The format of our PDB-style files is described here.)

Timeline for d3toib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3toia_