![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (52 species) not a true protein |
![]() | Species Clarkia breweri [TaxId:36903] [226317] (2 PDB entries) |
![]() | Domain d3tkya1: 3tky A:16-122 [216857] Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2 automated match to d1kyze1 complexed with n7i, sah |
PDB Entry: 3tky (more details), 2.47 Å
SCOPe Domain Sequences for d3tkya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkya1 a.4.5.0 (A:16-122) automated matches {Clarkia breweri [TaxId: 36903]} ssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
Timeline for d3tkya1: