Lineage for d3tjpa3 (3tjp A:525-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338713Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2338714Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2338715Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)
  8. 2338723Domain d3tjpa3: 3tjp A:525-725 [216844]
    Other proteins in same PDB: d3tjpa1, d3tjpa2, d3tjpa4
    automated match to d1e8ya1
    complexed with 13k, so4

Details for d3tjpa3

PDB Entry: 3tjp (more details), 2.7 Å

PDB Description: Crystal Structure of PI3K gamma with N6-(3,4-dimethoxyphenyl)-2-morpholino-[4,5'-bipyrimidine]-2',6-diamine
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3tjpa3:

Sequence, based on SEQRES records: (download)

>d3tjpa3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3tjpa3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
gcg

SCOPe Domain Coordinates for d3tjpa3:

Click to download the PDB-style file with coordinates for d3tjpa3.
(The format of our PDB-style files is described here.)

Timeline for d3tjpa3: