Lineage for d3tjoa_ (3tjo A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547699Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1547700Protein automated matches [190438] (19 species)
    not a true protein
  7. 1547722Species Human (Homo sapiens) [TaxId:9606] [187421] (42 PDB entries)
  8. 1547741Domain d3tjoa_: 3tjo A: [216839]
    automated match to d1l1ja_
    complexed with bog, gol, so4; mutant

Details for d3tjoa_

PDB Entry: 3tjo (more details), 2.3 Å

PDB Description: htra1 catalytic domain, mutationally inactivated
PDB Compounds: (A:) Serine protease HTRA1

SCOPe Domain Sequences for d3tjoa_:

Sequence, based on SEQRES records: (download)

>d3tjoa_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtna
hvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefv
vaigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnaggplvnldgev
igintlkvtagisfaipsdkikkflteshdr

Sequence, based on observed residues (ATOM records): (download)

>d3tjoa_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtna
hvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefv
vaigspfslqntvttgivsttqdyiqtdaiinygnaggplvnldgevigintlkvtagis
faipsdkikkflteshdr

SCOPe Domain Coordinates for d3tjoa_:

Click to download the PDB-style file with coordinates for d3tjoa_.
(The format of our PDB-style files is described here.)

Timeline for d3tjoa_: