SCOPe 2.04: Domain d3tcza1: 3tcz A:6-37

Lineage for d3tcza1 (3tcz A:6-37)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries)

8. Domain d3tcza1: 3tcz A:6-37 [216746]
   Other proteins in same PDB: d3tcza2
   automated match to d1f8ab1
   complexed with pe4, r2z

Details for d3tcza1

PDB Entry: 3tcz, 2.1 Å

PDB Description: human pin1 bound to cis peptidomimetic inhibitor

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3tcza1:

Sequence; same for both SEQRES and ATOM records:

>d3tcza1 b.72.1.1 (A:6-37) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
klppgwekamsrssgrvyyfnhitnasqwerp

Timeline for d3tcza1:

• d3tcza1 first appeared in SCOPe 2.03
  
• d3tcza1 appears in SCOPe 2.05
  
• d3tcza1 appears in the current release, SCOPe 2.08