Lineage for d3t88b_ (3t88 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585288Species Escherichia coli [TaxId:562] [196212] (2 PDB entries)
  8. 1585290Domain d3t88b_: 3t88 B: [216702]
    automated match to d3t89f_
    complexed with cl, gol, pge, s0n

Details for d3t88b_

PDB Entry: 3t88 (more details), 2 Å

PDB Description: crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa
PDB Compounds: (B:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d3t88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t88b_ c.14.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
deamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqaladar
yddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvva
mvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiw
flcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp

SCOPe Domain Coordinates for d3t88b_:

Click to download the PDB-style file with coordinates for d3t88b_.
(The format of our PDB-style files is described here.)

Timeline for d3t88b_: