SCOPe 2.05: Domain d1cdua2: 1cdu A:98-178

Lineage for d1cdua2 (1cdu A:98-178)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)

8. Domain d1cdua2: 1cdu A:98-178 [21662]
   Other proteins in same PDB: d1cdua1
   domain 2
   mutant

Details for d1cdua2

PDB Entry: 1cdu, 2.7 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with phe 43 replaced by val

PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cdua2:

Sequence; same for both SEQRES and ATOM records:

>d1cdua2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d1cdua2:

• d1cdua2 first appeared (with stable ids) in SCOP 1.55, called d1cdu_2
  
• d1cdua2 appears in SCOPe 2.04
  
• d1cdua2 appears in SCOPe 2.06
  
• d1cdua2 appears in the current release, SCOPe 2.08