SCOPe 2.06: Domain d3stic_: 3sti C:

Lineage for d3stic_ (3sti C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226179] (2 PDB entries)

8. Domain d3stic_: 3sti C: [216555]
   Other proteins in same PDB: d3stia2, d3stib2
   automated match to d1l1ja_

Details for d3stic_

PDB Entry: 3sti, 2.6 Å

PDB Description: Crystal structure of the protease domain of DegQ from Escherichia coli

PDB Compounds: (C:) Protease degQ

SCOPe Domain Sequences for d3stic_:

Sequence, based on SEQRES records:

>d3stic_ b.47.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii
naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia
dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga
llnlngeligintailapgggsvgigfaipsnmartlaqqlidf

Sequence, based on observed residues (ATOM records):

>d3stic_ b.47.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrglgsgviinaskgyvltnnhvikisiqlndgrefdaklig
sddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsg
lnleglenfiqtdasinrgnsggallnlngeligintailsvgigfaipsnmartlaqql
idf

Timeline for d3stic_:

• d3stic_ first appeared in SCOPe 2.03
  
• d3stic_ appears in SCOPe 2.05
  
• d3stic_ appears in SCOPe 2.07
  
• d3stic_ appears in the current release, SCOPe 2.08