| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) multihelical bundle; contains buried central helix |
Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) ![]() |
| Family a.89.1.0: automated matches [227272] (1 protein) not a true family |
| Protein automated matches [227075] (2 species) not a true protein |
| Species Uncultured archaeon [TaxId:115547] [226263] (1 PDB entry) |
| Domain d3sqge2: 3sqg E:184-433 [216511] Other proteins in same PDB: d3sqga1, d3sqgb1, d3sqgd1, d3sqge1, d3sqgg1, d3sqgh1 automated match to d1e6vb1 complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7 |
PDB Entry: 3sqg (more details), 2.1 Å
SCOPe Domain Sequences for d3sqge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sqge2 a.89.1.0 (E:184-433) automated matches {Uncultured archaeon [TaxId: 115547]}
gftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayeglna
nnllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwnayac
tamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffshsiy
ggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipefae
pmravaeaak
Timeline for d3sqge2: