Lineage for d1vcab1 (1vca B:91-199)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160328Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 160378Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)
  7. 160379Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)
  8. 160381Domain d1vcab1: 1vca B:91-199 [21650]
    Other proteins in same PDB: d1vcaa2, d1vcab2

Details for d1vcab1

PDB Entry: 1vca (more details), 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution

SCOP Domain Sequences for d1vcab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcab1 b.1.1.3 (B:91-199) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvyisp

SCOP Domain Coordinates for d1vcab1:

Click to download the PDB-style file with coordinates for d1vcab1.
(The format of our PDB-style files is described here.)

Timeline for d1vcab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcab2