Lineage for d3slcd2 (3slc D:200-400)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493360Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries)
  8. 2493372Domain d3slcd2: 3slc D:200-400 [216468]
    Other proteins in same PDB: d3slca3
    automated match to d1g99a2
    complexed with edo

Details for d3slcd2

PDB Entry: 3slc (more details), 2.7 Å

PDB Description: Crystal structure of apo form of acetate kinase (AckA) from Salmonella typhimurium
PDB Compounds: (D:) acetate kinase

SCOPe Domain Sequences for d3slcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slcd2 c.55.1.0 (D:200-400) automated matches {Salmonella enterica [TaxId: 90371]}
pveelniitchlgnggsvsairngkcvdtsmgltpleglvmgtrsgdidpaiifhlhdtl
gmsvdqinkmltkesgllgltevtsdcryvednyatkedakramdvychrlakyigsyta
lmdgrldavvftggigenaamvrelslgklgvlgfevdhernlaarfgksgfinkegtrp
avviptneelviaqdasrlta

SCOPe Domain Coordinates for d3slcd2:

Click to download the PDB-style file with coordinates for d3slcd2.
(The format of our PDB-style files is described here.)

Timeline for d3slcd2: