![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (63 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries) |
![]() | Domain d3slcd2: 3slc D:200-400 [216468] Other proteins in same PDB: d3slca3 automated match to d1g99a2 complexed with edo |
PDB Entry: 3slc (more details), 2.7 Å
SCOPe Domain Sequences for d3slcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3slcd2 c.55.1.0 (D:200-400) automated matches {Salmonella enterica [TaxId: 90371]} pveelniitchlgnggsvsairngkcvdtsmgltpleglvmgtrsgdidpaiifhlhdtl gmsvdqinkmltkesgllgltevtsdcryvednyatkedakramdvychrlakyigsyta lmdgrldavvftggigenaamvrelslgklgvlgfevdhernlaarfgksgfinkegtrp avviptneelviaqdasrlta
Timeline for d3slcd2: