SCOPe 2.04: Domain d3si9d_: 3si9 D:

Lineage for d3si9d_ (3si9 D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (57 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [189345] (2 PDB entries)

8. Domain d3si9d_: 3si9 D: [216421]
   automated match to d3flua_
   complexed with edo

Details for d3si9d_

PDB Entry: 3si9, 2.1 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from bartonella henselae

PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3si9d_:

Sequence; same for both SEQRES and ATOM records:

>d3si9d_ c.1.10.0 (D:) automated matches {Bartonella henselae [TaxId: 38323]}
smlkgavtalitpfddngaidekafcnfvewqitqgingvspvgttgesptltheehkri
ielcveqvakrvpvvagagsnstseavelakhaekagadavlvvtpyynrpnqrglythf
ssiakaisipiiiynipsrsvidmavetmrdlcrdfkniigvkdatgkieraseqrekcg
kdfvqlsgddctalgfnahggvgcisvssnvapklcaqlhaaclcsdyktalklndllmp
lnravfiepspagikyaaaklglcgtivrspivplsdttkkiidealyhagllk

Timeline for d3si9d_:

• d3si9d_ first appeared in SCOPe 2.03
  
• d3si9d_ appears in SCOPe 2.05
  
• d3si9d_ appears in the current release, SCOPe 2.08, called d3si9d1