Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (57 species) not a true protein |
Species Bartonella henselae [TaxId:38323] [189345] (2 PDB entries) |
Domain d3si9d_: 3si9 D: [216421] automated match to d3flua_ complexed with edo |
PDB Entry: 3si9 (more details), 2.1 Å
SCOPe Domain Sequences for d3si9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3si9d_ c.1.10.0 (D:) automated matches {Bartonella henselae [TaxId: 38323]} smlkgavtalitpfddngaidekafcnfvewqitqgingvspvgttgesptltheehkri ielcveqvakrvpvvagagsnstseavelakhaekagadavlvvtpyynrpnqrglythf ssiakaisipiiiynipsrsvidmavetmrdlcrdfkniigvkdatgkieraseqrekcg kdfvqlsgddctalgfnahggvgcisvssnvapklcaqlhaaclcsdyktalklndllmp lnravfiepspagikyaaaklglcgtivrspivplsdttkkiidealyhagllk
Timeline for d3si9d_: