SCOP 1.73: Domain d1iebb1: 1ieb B:93-188

Lineage for d1iebb1 (1ieb B:93-188)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
probably orthologous to the human HLA-DR group
Domain d1iebb1: 1ieb B:93-188 [21636]
Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb2, d1iebc1, d1iebc2, d1iebd2

Details for d1iebb1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

PDB Compounds: (B:) MHC class II I-ek

SCOP Domain Sequences for d1iebb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebb1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOP Domain Coordinates for d1iebb1:

Click to download the PDB-style file with coordinates for d1iebb1.
(The format of our PDB-style files is described here.)

Timeline for d1iebb1: