SCOPe 2.08: Domain d1iebb1: 1ieb B:93-188

Lineage for d1iebb1 (1ieb B:93-188)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1iebb1: 1ieb B:93-188 [21636]
   Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb2, d1iebc1, d1iebc2, d1iebd2
   contains covalently bound peptides at the N-termini of chains B and D
   complexed with nag, so4

Details for d1iebb1

PDB Entry: 1ieb, 2.7 Å

PDB Description: histocompatibility antigen

PDB Compounds: (B:) MHC class II I-ek

SCOPe Domain Sequences for d1iebb1:

Sequence; same for both SEQRES and ATOM records:

>d1iebb1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

Timeline for d1iebb1:

• d1iebb1 first appeared (with stable ids) in SCOP 1.55
  
• d1iebb1 appears in SCOPe 2.07