Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein automated matches [227076] (2 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226274] (4 PDB entries) |
Domain d3s7qa2: 3s7q A:138-323 [216235] Other proteins in same PDB: d3s7qa1 automated match to d1ztua1 complexed with gol, lbv, lbw, po4 |
PDB Entry: 3s7q (more details), 1.75 Å
SCOPe Domain Sequences for d3s7qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s7qa2 d.110.2.1 (A:138-323) automated matches {Deinococcus radiodurans [TaxId: 1299]} halrnamsalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglha flghrfpashipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlrats pmhmqflrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrelseqvq vkeale
Timeline for d3s7qa2: