SCOPe 2.03: Domain d3s7pa1: 3s7p A:5-130

Lineage for d3s7pa1 (3s7p A:5-130)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (10 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [226273] (4 PDB entries)

8. Domain d3s7pa1: 3s7p A:5-130 [216232]
   Other proteins in same PDB: d3s7pa2
   automated match to d1ztua2
   complexed with lbv

Details for d3s7pa1

PDB Entry: 3s7p, 1.72 Å

PDB Description: Crystal Structure of the Infrared Fluorescent D207H variant of Deinococcus Bacteriophytochrome chromophore binding domain at 1.72 angstrom resolution

PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3s7pa1:

Sequence; same for both SEQRES and ATOM records:

>d3s7pa1 d.110.3.0 (A:5-130) automated matches {Deinococcus radiodurans [TaxId: 1299]}
plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq
eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellil
efepte

Timeline for d3s7pa1:

• d3s7pa1 is new in SCOPe 2.03-stable
  
• d3s7pa1 appears in SCOPe 2.04
  
• d3s7pa1 appears in the current release, SCOPe 2.08