SCOPe 2.06: Domain d3s4tg1: 3s4t G:1-326

Lineage for d3s4tg1 (3s4t G:1-326)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein automated matches [227068] (1 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [226195] (1 PDB entry)

8. Domain d3s4tg1: 3s4t G:1-326 [216205]
   Other proteins in same PDB: d3s4ta2, d3s4tg2
   automated match to d2dvxa_
   complexed with act, cl, epe, gol, so4

Details for d3s4tg1

PDB Entry: 3s4t, 1.9 Å

PDB Description: crystal structure of putative amidohydrolase-2 (efi-target 500288)from polaromonas sp. js666

PDB Compounds: (G:) Amidohydrolase 2

SCOPe Domain Sequences for d3s4tg1:

Sequence; same for both SEQRES and ATOM records:

>d3s4tg1 c.1.9.15 (G:1-326) automated matches {Polaromonas sp. [TaxId: 296591]}
mngkialeehfateetlmdsagfvpdkdwpelrsrlldiqdrrvrlmdehgietmilsln
apavqaiadstranetarrandflaeqvakqptrfrgfaalpmqdpelaarelercvkel
gfvgalvngfsqdnrsavplyydmaqywpfwetvqaldvpfylhprnplpsdariydgha
wllgptwafgqetavhalrlmgsglfdkypalkiilghmgeglpysmwridhrnawiktt
pkypakrkivdyfnenfylttsgnfrtqtlidaileigadrilfstdwpfenidhaadwf
entsiseadrkkigwgnaqnlfklnr

Timeline for d3s4tg1:

• d3s4tg1 first appeared in SCOPe 2.03, called d3s4tg_
  
• d3s4tg1 was called d3s4tg_ in SCOPe 2.05
  
• d3s4tg1 appears in SCOPe 2.07
  
• d3s4tg1 appears in the current release, SCOPe 2.08