Lineage for d3s1ca1 (3s1c A:33-245)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675950Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 1675951Protein automated matches [191143] (7 species)
    not a true protein
  7. 1675956Species Maize (Zea mays) [TaxId:4577] [225479] (10 PDB entries)
  8. 1675966Domain d3s1ca1: 3s1c A:33-245 [216155]
    Other proteins in same PDB: d3s1ca2
    automated match to d1w1oa2
    complexed with 15p, fad, gol, nag, peg, zir

Details for d3s1ca1

PDB Entry: 3s1c (more details), 2.09 Å

PDB Description: maize cytokinin oxidase/dehydrogenase complexed with n6- isopentenyladenosine
PDB Compounds: (A:) cytokinin dehydrogenase 1

SCOPe Domain Sequences for d3s1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1ca1 d.145.1.0 (A:33-245) automated matches {Maize (Zea mays) [TaxId: 4577]}
pwpaslaalaldgklrtdsnataaastdfgnitsalpaavlypsstadlvallsaanstp
gwpytiafrgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwid
vlraslargvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvt
cskqlnadlfdavlgglgqfgvitrariavepa

SCOPe Domain Coordinates for d3s1ca1:

Click to download the PDB-style file with coordinates for d3s1ca1.
(The format of our PDB-style files is described here.)

Timeline for d3s1ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s1ca2