Lineage for d3ry4a2 (3ry4 A:89-173)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764808Protein automated matches [190803] (2 species)
    not a true protein
  7. 1764809Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries)
  8. 1764814Domain d3ry4a2: 3ry4 A:89-173 [216114]
    automated match to d1fcga2
    complexed with gol, nag

Details for d3ry4a2

PDB Entry: 3ry4 (more details), 1.5 Å

PDB Description: 1.5 angstrom resolution structure of glycosylated fcgammariia (low- responder polymorphism)
PDB Compounds: (A:) Low affinity immunoglobulin gamma Fc region receptor II-a

SCOPe Domain Sequences for d3ry4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ry4a2 b.1.1.4 (A:89-173) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfshldptfsipqanhsh
sgdyhctgnigytlfsskpvtitvq

SCOPe Domain Coordinates for d3ry4a2:

Click to download the PDB-style file with coordinates for d3ry4a2.
(The format of our PDB-style files is described here.)

Timeline for d3ry4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ry4a1