Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries) |
Domain d3ry4a2: 3ry4 A:89-173 [216114] automated match to d1fcga2 complexed with gol, nag |
PDB Entry: 3ry4 (more details), 1.5 Å
SCOPe Domain Sequences for d3ry4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ry4a2 b.1.1.4 (A:89-173) automated matches {Human (Homo sapiens) [TaxId: 9606]} ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfshldptfsipqanhsh sgdyhctgnigytlfsskpvtitvq
Timeline for d3ry4a2: