PDB entry 3ry4

View 3ry4 on RCSB PDB site
Description: 1.5 Angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
Class: immune system
Keywords: fc receptor, cd32, immunoglobulin superfamily, low responder polymorphism, cell membrane, glycoprotein, igg-binding protein, immunoglobulin domain, membrane, phosphoprotein, receptor, transmembrane, immune system
Deposited on 2011-05-11, released 2011-08-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin gamma Fc region receptor II-a
    Species: Homo sapiens [TaxId:9606]
    Gene: CD32, FCG2, FCGR2A, FCGR2A1, IGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12318 (0-169)
      • engineered mutation (84)
    Domains in SCOPe 2.05: d3ry4a1, d3ry4a2
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ry4A (A:)
    appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
    ndsgeytcqtgqtslsdpvhltvlfewlvlqtphlefqegetimlrchswkdkplvkvtf
    fqngksqkfshldptfsipqanhshsgdyhctgnigytlfsskpvtitvq