Lineage for d3rv5c_ (3rv5 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324288Protein Troponin C [47503] (6 species)
  7. 2324323Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)
  8. 2324329Domain d3rv5c_: 3rv5 C: [216080]
    automated match to d1mxlc_
    complexed with ca, cd, dxc

Details for d3rv5c_

PDB Entry: 3rv5 (more details), 2.2 Å

PDB Description: Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium and deoxycholic acid
PDB Compounds: (C:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d3rv5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rv5c_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
diykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqemid
evdedgsgtvdfdeflvmmvrcm

SCOPe Domain Coordinates for d3rv5c_:

Click to download the PDB-style file with coordinates for d3rv5c_.
(The format of our PDB-style files is described here.)

Timeline for d3rv5c_: