SCOPe 2.08: Domain d3rswb_: 3rsw B:

Lineage for d3rswb_ (3rsw B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries)

8. Domain d3rswb_: 3rsw B: [216041]
   automated match to d1hmsa_

Details for d3rswb_

PDB Entry: 3rsw, 2.6 Å

PDB Description: Crystal Structure of Heart Fatty Acid Binding Protein (FABP3)

PDB Compounds: (B:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d3rswb_:

Sequence; same for both SEQRES and ATOM records:

>d3rswb_ b.60.1.2 (B:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

Timeline for d3rswb_:

• d3rswb_ first appeared in SCOPe 2.03
  
• d3rswb_ appears in SCOPe 2.07