Lineage for d3rrha1 (3rrh A:295-422)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139729Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2139920Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2139985Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries)
  8. 2139987Domain d3rrha1: 3rrh A:295-422 [216019]
    Other proteins in same PDB: d3rrha2
    automated match to d1jxea1
    protein/DNA complex; complexed with act, gol, mg, pge, ttp

Details for d3rrha1

PDB Entry: 3rrh (more details), 1.8 Å

PDB Description: Ternary Structure of the large fragment of Taq DNA polymerase bound to an abasic site and a ddTTP
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d3rrha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrha1 c.55.3.5 (A:295-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
eeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllak
dlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfa
nlwgrleg

SCOPe Domain Coordinates for d3rrha1:

Click to download the PDB-style file with coordinates for d3rrha1.
(The format of our PDB-style files is described here.)

Timeline for d3rrha1: