Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries) |
Domain d3ro6f1: 3ro6 F:1-125 [215938] Other proteins in same PDB: d3ro6a2, d3ro6b2, d3ro6c2, d3ro6d2, d3ro6e2, d3ro6f2 automated match to d1jpma2 complexed with gol, mg, so4 |
PDB Entry: 3ro6 (more details), 2.2 Å
SCOPe Domain Sequences for d3ro6f1:
Sequence, based on SEQRES records: (download)
>d3ro6f1 d.54.1.0 (F:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]} mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv eilgr
>d3ro6f1 d.54.1.0 (F:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]} mkiadiqvrtehfplteeidnliveirtadgllglgaasperhvtgetleachaaldhdr lgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgr
Timeline for d3ro6f1: