Lineage for d3ro6d1 (3ro6 D:1-125)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649541Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries)
  8. 1649545Domain d3ro6d1: 3ro6 D:1-125 [215934]
    Other proteins in same PDB: d3ro6a2, d3ro6b2, d3ro6c2, d3ro6d2, d3ro6e2, d3ro6f2
    automated match to d1jpma2
    complexed with gol, mg, so4

Details for d3ro6d1

PDB Entry: 3ro6 (more details), 2.2 Å

PDB Description: crystal structure of dipeptide epimerase from methylococcus capsulatus complexed with mg ion
PDB Compounds: (D:) Putative chloromuconate cycloisomerase

SCOPe Domain Sequences for d3ro6d1:

Sequence, based on SEQRES records: (download)

>d3ro6d1 d.54.1.0 (D:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
eilgr

Sequence, based on observed residues (ATOM records): (download)

>d3ro6d1 d.54.1.0 (D:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfplteidnliveirtadgllglgaasperhvtgetleachaaldhdrl
gwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgr

SCOPe Domain Coordinates for d3ro6d1:

Click to download the PDB-style file with coordinates for d3ro6d1.
(The format of our PDB-style files is described here.)

Timeline for d3ro6d1: