SCOPe 2.08: Domain d3ridb_: 3rid B:

Lineage for d3ridb_ (3rid B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d3ridb_: 3rid B: [215831]
   automated match to d3rh1a_
   complexed with cgp, po4

Details for d3ridb_

PDB Entry: 3rid, 2.18 Å

PDB Description: X-ray structure of the C-terminal swapped dimer of P114A variant of Ribonuclease A

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3ridb_:

Sequence; same for both SEQRES and ATOM records:

>d3ridb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnayvpvhf
dasv

Timeline for d3ridb_:

• d3ridb_ first appeared in SCOPe 2.03
  
• d3ridb_ appears in SCOPe 2.07