Lineage for d3rcfa_ (3rcf A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553467Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 1553468Species Human (Homo sapiens) [TaxId:9606] [141512] (27 PDB entries)
    Uniprot P30405 44-207
  8. 1553478Domain d3rcfa_: 3rcf A: [215717]
    automated match to d3rdax_
    complexed with bs4

Details for d3rcfa_

PDB Entry: 3rcf (more details), 1.15 Å

PDB Description: human cyclophilin d complexed with n-[(4-aminophenyl) sulfonyl]benzamide
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d3rcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rcfa_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d3rcfa_:

Click to download the PDB-style file with coordinates for d3rcfa_.
(The format of our PDB-style files is described here.)

Timeline for d3rcfa_: