Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily) 4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha |
Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) |
Family e.11.1.0: automated matches [191600] (1 protein) not a true family |
Protein automated matches [191091] (4 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225775] (3 PDB entries) |
Domain d3raeb_: 3rae B: [215685] Other proteins in same PDB: d3raec_, d3raed_ automated match to d1ab4a_ protein/DNA complex; complexed with lfx, mg |
PDB Entry: 3rae (more details), 2.9 Å
SCOPe Domain Sequences for d3raeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3raeb_ e.11.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} niqnmsledimgerfgryskyiiqdralpdirdglkpvqrrilysmnkdsntfdksyrks aksvgnimgnfhphgdssiydamvrmsqnwknreilvemhgnngsmdgdppaamrytear lseiagyllqdiekktvpfawnfddtekeptvlpaafpnllvngstgisagyatdipphn laevidaavymidhptakidklmeflpgpdfptgaiiqgrdeikkayetgkgrvvvrskt eieklkggkeqiviteipyeinkanlvkkiddvrvnnkvagiaevrdesdrdglriaiel kkdantelvlnylfkytdlqinynfnmvaidnftprqvgivpilssyiahrrevilarsr fdkekaekrlhiveglirvisildevialirasenkadakenlkvsydfteeqaeaivtl qlyrltntdvvvlqeeeaelrekiamlaaiigdertmynlmkkelrevkkkfatprlssl ed
Timeline for d3raeb_: