Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141512] (46 PDB entries) Uniprot P30405 44-207 |
Domain d3r4ga_: 3r4g A: [215570] automated match to d3rdax_ complexed with 4so, gol |
PDB Entry: 3r4g (more details), 1.05 Å
SCOPe Domain Sequences for d3r4ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r4ga_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls
Timeline for d3r4ga_: