Lineage for d3r49a_ (3r49 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553467Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 1553468Species Human (Homo sapiens) [TaxId:9606] [141512] (27 PDB entries)
    Uniprot P30405 44-207
  8. 1553493Domain d3r49a_: 3r49 A: [215569]
    automated match to d3rdax_
    complexed with q8a

Details for d3r49a_

PDB Entry: 3r49 (more details), 1.77 Å

PDB Description: human cyclophilin d complexed with quinolin-8-amine
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d3r49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r49a_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d3r49a_:

Click to download the PDB-style file with coordinates for d3r49a_.
(The format of our PDB-style files is described here.)

Timeline for d3r49a_: