| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Francisella philomiragia [TaxId:484022] [226097] (5 PDB entries) |
| Domain d3r1zb1: 3r1z B:2-127 [215537] Other proteins in same PDB: d3r1za2, d3r1zb2 automated match to d1wufa2 complexed with ala, dgl, glu, gol, so4 |
PDB Entry: 3r1z (more details), 1.9 Å
SCOPe Domain Sequences for d3r1zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r1zb1 d.54.1.0 (B:2-127) automated matches {Francisella philomiragia [TaxId: 484022]}
vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
akllga
Timeline for d3r1zb1: