Lineage for d3r10a1 (3r10 A:2-127)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905530Species Francisella philomiragia [TaxId:484022] [226097] (5 PDB entries)
  8. 1905537Domain d3r10a1: 3r10 A:2-127 [215517]
    Other proteins in same PDB: d3r10a2, d3r10b2
    automated match to d1wufa2
    complexed with gol, mg, so4

Details for d3r10a1

PDB Entry: 3r10 (more details), 2 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Mg complex
PDB Compounds: (A:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r10a1 d.54.1.0 (A:2-127) automated matches {Francisella philomiragia [TaxId: 484022]}
vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
akllga

SCOPe Domain Coordinates for d3r10a1:

Click to download the PDB-style file with coordinates for d3r10a1.
(The format of our PDB-style files is described here.)

Timeline for d3r10a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r10a2