Lineage for d3r10a1 (3r10 A:3-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948245Species Francisella philomiragia [TaxId:484022] [226097] (5 PDB entries)
  8. 2948252Domain d3r10a1: 3r10 A:3-127 [215517]
    Other proteins in same PDB: d3r10a2, d3r10a3, d3r10a4, d3r10b2, d3r10b3, d3r10b4
    automated match to d1wufa2
    complexed with gol, mg, so4

Details for d3r10a1

PDB Entry: 3r10 (more details), 2 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Mg complex
PDB Compounds: (A:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r10a1 d.54.1.0 (A:3-127) automated matches {Francisella philomiragia [TaxId: 484022]}
skiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtlq
gmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisva
kllga

SCOPe Domain Coordinates for d3r10a1:

Click to download the PDB-style file with coordinates for d3r10a1.
(The format of our PDB-style files is described here.)

Timeline for d3r10a1: