Lineage for d3qtpb2 (3qtp B:139-436)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446101Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226173] (1 PDB entry)
  8. 2446103Domain d3qtpb2: 3qtp B:139-436 [215406]
    Other proteins in same PDB: d3qtpa1, d3qtpa3, d3qtpb1, d3qtpb3
    automated match to d1pdza1
    complexed with 2pg, mg, so4

Details for d3qtpb2

PDB Entry: 3qtp (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Entamoeba histolytica Enolase
PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d3qtpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qtpb2 c.1.11.0 (B:139-436) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
kemtmpvpcfnvinggahagnalamqefmicptgatnfhealrmaaetyqclkvvikaky
gqdatnvgdeggfapnvsgarealdllveaiakagytgkieiamdcaasefyneetkkyd
lgkkipadkkdpslvkdvdgliaeyvdygkhypiasiedpfaeddwaawnkftvehgnfq
ivgddllvtnparvqmamdknacnsvlikvnqigtltetfktikmaqekgwgvmashrsg
etedtfiadlvvglnckqiktgapcrserlckynqlmrieeelgnipyagknwrnsta

SCOPe Domain Coordinates for d3qtpb2:

Click to download the PDB-style file with coordinates for d3qtpb2.
(The format of our PDB-style files is described here.)

Timeline for d3qtpb2: