Lineage for d3qn3a2 (3qn3 A:137-414)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344152Species Campylobacter jejuni [TaxId:197] [226083] (1 PDB entry)
  8. 1344153Domain d3qn3a2: 3qn3 A:137-414 [215301]
    Other proteins in same PDB: d3qn3a1, d3qn3b1, d3qn3c1, d3qn3d1
    automated match to d1w6ta1
    complexed with gol, mg, mpd, so4

Details for d3qn3a2

PDB Entry: 3qn3 (more details), 2.13 Å

PDB Description: phosphopyruvate hydratase from campylobacter jejuni.
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d3qn3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qn3a2 c.1.11.0 (A:137-414) automated matches {Campylobacter jejuni [TaxId: 197]}
nasilpvpmcniinggahannnvdfqefmimpfgftsfkealrsvceiyailkkelansg
hstalgdeggfapnlanntepidllmtcikkagyenrvkialdvasteffkdgkyhmegk
afssealieryvelcakypicsiedglaendfegwiklteklgnkiqlvgddlfvtnedi
lregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvmshrsgesedafiadfava
lntgqiktgalargertakynrlleiefesdeylgekl

SCOPe Domain Coordinates for d3qn3a2:

Click to download the PDB-style file with coordinates for d3qn3a2.
(The format of our PDB-style files is described here.)

Timeline for d3qn3a2: