Lineage for d1w6ta1 (1w6t A:138-433)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) 
binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily
Family c.1.11.1: Enolase [51605] (2 proteins)
automatically mapped to Pfam PF00113Protein Enolase [51606] (9 species)
Fold of this protein slightly differs from common fold in topology
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141843] (1 PDB entry)
Uniprot Q8DPS0 138-433
Domain d1w6ta1: 1w6t A:138-433 [120670]
Other proteins in same PDB: d1w6ta2, d1w6tb2
complexed with 2pe, mg
Details for d1w6ta1
PDB Entry: 1w6t (more details), 2.1 Å
PDB Description: crystal structure of octameric enolase from streptococcus pneumoniae
PDB Compounds: (A:) enolaseSCOPe Domain Sequences for d1w6ta1:
Sequence, based on SEQRES records: (download)
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ntkvlptpmmniinggshsdapiafqefmilpvgaptfkealrygaeifhalkkilksrg
letavgdeggfaprfegtedgvetilaaieaagyvpgkdvflgfdcassefydkerkvyd
ytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkkvqlvg
ddffvtntdylargiqegaansilikvnqigtltetfeaiemakeagytavvshrsgete
dstiadiavatnagqiktgslsrtdriakynqllriedqlgevaeyrglksfynlk
Sequence, based on observed residues (ATOM records): (download)
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ntkvlptpmmniinggshsdapiafqefmilpvgaptfkealrygaeifhalkkilksrg
letavgdeggfaprfegtedgvetilaaieaagyvpgkdvflgfdcassefydrkvydyt
kfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkkvqlvgdd
ffvtntdylargiqegaansilikvnqigtltetfeaiemakeagytavvshrsgeteds
tiadiavatnagqiktgslsrtdriakynqllriedqlgevaeyrglksfynlk
SCOPe Domain Coordinates for d1w6ta1:
Click to download the PDB-style file with coordinates for d1w6ta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w6ta1:
- d1w6ta1 first appeared in SCOP 1.73
- d1w6ta1 appears in SCOPe 2.02
- d1w6ta1 appears in SCOPe 2.04
- d1w6ta1 appears in the current release, SCOPe 2.08
View in 3D
