Lineage for d3qfpa1 (3qfp A:49-233)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606136Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)
  8. 1606143Domain d3qfpa1: 3qfp A:49-233 [215214]
    automated match to d1qqma1
    complexed with po4

Details for d3qfpa1

PDB Entry: 3qfp (more details), 2.26 Å

PDB Description: Crystal structure of yeast Hsp70 (Bip/Kar2) ATPase domain
PDB Compounds: (A:) 78 kDa glucose-regulated protein homolog

SCOPe Domain Sequences for d3qfpa1:

Sequence, based on SEQRES records: (download)

>d3qfpa1 c.55.1.0 (A:49-233) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ygtvigidlgttyscvavmkngkteilaneqgnritpsyvaftdderligdaaknqvaan
pqntifdikrliglkyndrsvqkdikhlpfnvvnkdgkpavevsvkgekkvftpeeisgm
ilgkmkqiaedylgtkvthavvtvpayfndaqrqatkdagtiaglnvlrivneptaaaia
ygldk

Sequence, based on observed residues (ATOM records): (download)

>d3qfpa1 c.55.1.0 (A:49-233) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ygtvigidlgttyscvavmkteilaneqgnritpsyvaftdderligdaaknqvaanpqn
tifdikrliglkyndrsvqkdilpfnvvnkdgkpavevsvkgekkvftpeeisgmilgkm
kqiaedylgtkvthavvtvpayfndaqrqatkdagtiaglnvlrivneptaaaiaygldk

SCOPe Domain Coordinates for d3qfpa1:

Click to download the PDB-style file with coordinates for d3qfpa1.
(The format of our PDB-style files is described here.)

Timeline for d3qfpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qfpa2