Lineage for d3q93a_ (3q93 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428506Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1428644Protein automated matches [190465] (3 species)
    not a true protein
  7. 1428657Species Human (Homo sapiens) [TaxId:9606] [189707] (9 PDB entries)
  8. 1428662Domain d3q93a_: 3q93 A: [215131]
    automated match to d3zr0b_
    complexed with gol, imd, so4

Details for d3q93a_

PDB Entry: 3q93 (more details), 1.8 Å

PDB Description: Crystal Structure of Human 8-oxo-dGTPase (MTH1)
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d3q93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q93a_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d3q93a_:

Click to download the PDB-style file with coordinates for d3q93a_.
(The format of our PDB-style files is described here.)

Timeline for d3q93a_: