Lineage for d1b6da2 (1b6d A:108-212)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289665Domain d1b6da2: 1b6d A:108-212 [21510]
    Other proteins in same PDB: d1b6da1, d1b6db1

Details for d1b6da2

PDB Entry: 1b6d (more details), 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

SCOP Domain Sequences for d1b6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6da2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1b6da2:

Click to download the PDB-style file with coordinates for d1b6da2.
(The format of our PDB-style files is described here.)

Timeline for d1b6da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6da1