SCOPe 2.08: Domain d1b6da2: 1b6d A:108-212

Lineage for d1b6da2 (1b6d A:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1b6da2: 1b6d A:108-212 [21510]
   Other proteins in same PDB: d1b6da1, d1b6db1
   part of Bence-Jones protein DEL

Details for d1b6da2

PDB Entry: 1b6d, 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

PDB Compounds: (A:) immunoglobulin

SCOPe Domain Sequences for d1b6da2:

Sequence; same for both SEQRES and ATOM records:

>d1b6da2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1b6da2:

• d1b6da2 first appeared (with stable ids) in SCOP 1.55
  
• d1b6da2 appears in SCOPe 2.07