Lineage for d3q0ea2 (3q0e A:133-354)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568241Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2568248Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 2568324Species Vibrio cholerae [TaxId:666] [82725] (4 PDB entries)
  8. 2568329Domain d3q0ea2: 3q0e A:133-354 [215008]
    Other proteins in same PDB: d3q0ea1, d3q0eb1
    automated match to d1mb4a2
    complexed with act, cys, edo, so4

Details for d3q0ea2

PDB Entry: 3q0e (more details), 1.8 Å

PDB Description: Crystals Structure of Aspartate beta-Semialdehyde Dehydrogenase from Vibrio Cholerae with product of S-allyl-L-cysteine sulfoxide
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3q0ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0ea2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}
nctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgvindavsselanp
assildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqskeewkagveankil
glqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathndwvkvipnerdit
areltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwg

SCOPe Domain Coordinates for d3q0ea2:

Click to download the PDB-style file with coordinates for d3q0ea2.
(The format of our PDB-style files is described here.)

Timeline for d3q0ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q0ea1