Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [226199] (3 PDB entries) |
Domain d3pzvd_: 3pzv D: [215003] automated match to d2cksa_ |
PDB Entry: 3pzv (more details), 2.87 Å
SCOPe Domain Sequences for d3pzvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzvd_ c.1.8.0 (D:) automated matches {Bacillus subtilis [TaxId: 224308]} tpvakngqlsikgtqlvnrdgkavqlkgisshglqwygeyvnkdslkwlrddwgitvfra amytadggyidnpsvknkvkeaveaakelgiyviidwhilndgnpnqnkekakeffkems slygntpnviyeianepngdvnwkrdikpyaeevisvirkndpdniiivgtgtwsqdvnd aaddqlkdanvmyalhfyagthgqflrdkanyalskgapifvtewgtsdasgnggvfldq srewlkyldsktiswvnwnlsdkqesssalkpgasktggwrlsdlsasgtfvrenilg
Timeline for d3pzvd_: