| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (26 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries) |
| Domain d3pqfd2: 3pqf D:148-314 [214932] Other proteins in same PDB: d3pqfa1, d3pqfb1, d3pqfc1, d3pqfd1 automated match to d1llca2 complexed with nad; mutant |
PDB Entry: 3pqf (more details), 2.49 Å
SCOPe Domain Sequences for d3pqfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pqfd2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf
Timeline for d3pqfd2: